Horchow.com valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot /
BingBot /
BaiduSpider /
YandexBot /
Meta Tags
Title Designer Furniture and Home Dècor at Horchow
Description Shop designer furniture and home dècor at Horchow. Discover luxury accessories and exclusive home details you won’t find anywhere else.
Keywords N/A
Server Information
WebSite horchow favicon www.horchow.com
Host IP 151.101.2.133
Location United States
Related Websites
Site Rank
onekingslane.com #39,432
frontgate.com #37,364
ballarddesigns.com #29,204
burkedecor.com #26,137
perigold.com #20,956
More to Explore
essayswriting.org
prokatmedia.ru
ojk888.com
kliniklab.com
kerimyapiasmatavansistemleri.com
isaiminiyo.com
fiberkala.com
1com.net
ps4database.io
dusmezpolyester.com
cnbcnews.co.kr
coexwedding.com
Horchow.com Valuation
US$318,350
Last updated: Sep 15, 2021

Horchow.com has global traffic rank of 185,627 and ranks the 33,702nd in United States. Its global rank has gone down by 108,437 positions since 3 months ago. Horchow.com has an estimated worth of US$ 318,350, based on its estimated Ads revenue. Horchow.com receives approximately 17,101 unique visitors each day. Its web server is located in United States, with IP address 151.101.2.133. According to SiteAdvisor, horchow.com is safe to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$318,350
Daily Ads Revenue US$174
Monthly Ads Revenue US$5,233
Yearly Ads Revenue US$63,670
Daily Unique Visitors 17,101
Note: All traffic and earnings values are estimates.
Traffic Ranks
Global Rank 185,627
Delta (90 Days) ⬇️ 108,437
Most Popular In Country United States
Country Rank 33,702
DNS Records
Host Type TTL Data
horchow.com A 300 IP: 151.101.66.133
horchow.com A 300 IP: 151.101.2.133
horchow.com A 300 IP: 151.101.194.133
horchow.com A 300 IP: 151.101.130.133
horchow.com MX 300 Priority: 10
Target: mxb-003b7f01.gslb.pphosted.com.
horchow.com MX 300 Priority: 10
Target: mxa-003b7f01.gslb.pphosted.com.
horchow.com NS 21600 Target: ns-1554.awsdns-02.co.uk.
horchow.com NS 21600 Target: ns-265.awsdns-33.com.
horchow.com NS 21600 Target: ns-661.awsdns-18.net.
horchow.com NS 21600 Target: ns-1183.awsdns-19.org.
horchow.com TXT 300 TXT: MS=ms61105650
horchow.com TXT 300 TXT: adobe-idp-site-verification=28d548b57878b79705d4644999d1777988a3d20c211f7e8d40346ba0827f7233
horchow.com TXT 300 TXT: c595e8d5591543469533efc341e60b55
horchow.com TXT 300 TXT: globalsign-domain-verification=DyhW6l8hxNEE1ZG-CYKNeBEsbrEmnfu4_FuGNkRGvK
horchow.com TXT 300 TXT: v=spf1 a mx ip4:204.0.69.0/24 ip4:216.71.150.51/32 ip4:216.71.155.149/32 ip4:205.220.179.174 ip4:205.220.167.173 ip4:148.163.133.40 ip4:148.163.137.40" " exists:%{i}.spf.hc1988-47.iphmx.com exists:%{i}.spf.hc1988-57.iphmx.com include:sendgrid.net include:%{ir}.%{v}.%{d}.spf.has.pphosted.com -all
horchow.com SOA 900 MNAME: ns-661.awsdns-18.net.
RNAME: awsdns-hostmaster.amazon.com.
Serial: 1
Refresh: 7200
Retry: 900
Expire: 1209600
Minimum TTL: 86400
HTTP Headers
HTTP/1.1 301 Moved Permanently
Server: Varnish
Retry-After: 0
Location: https://www.horchow.com/
Content-Length: 0
Accept-Ranges: bytes
Date: Wed, 15 Sep 2021 14:43:54 GMT
Via: 1.1 varnish
Connection: close
X-Served-By: cache-lga21930-LGA
X-Cache: HIT
X-Cache-Hits: 0
Strict-Transport-Security: max-age=31557600; includeSubDomains; preload

HTTP/2 403 
server: Varnish
retry-after: 0
content-type: text/html
accept-ranges: bytes
date: Wed, 15 Sep 2021 14:43:54 GMT
via: 1.1 varnish
set-cookie: _pxhd=3A8XWb/LFlB0M3-UgcpVyVd8ljG965VIgNLANp1IhJAA8/pIQxyn1llBgd1YyPWwoEAhhOdxKBkAsmQ2s0tU2w==:-BBChuRn90ZeiXfIa4Vqa1I--RhbeOyqGNEApS8asQTJcur0Fkt0t3A52lQU-JfW6P9O7w2kokYnhQyk8SU9ArVmdw8P6Tobk9jpzw8TsIg=; Expires=Thu, 15 Sep 2022 14:43:54 GMT; path=/;
x-table-matched: 403-10-ab
x-served-by: cache-lga21974-LGA
x-cache: MISS
x-cache-hits: 0
strict-transport-security: max-age=31557600; includeSubDomains; preload
content-length: 3601

Horchow.com Whois Information
   Domain Name: HORCHOW.COM
   Registry Domain ID: 305895_DOMAIN_COM-VRSN
   Registrar WHOIS Server: whois.corporatedomains.com
   Registrar URL: http://cscdbs.com
   Updated Date: 2021-01-31T06:09:15Z
   Creation Date: 1996-02-03T05:00:00Z
   Registry Expiry Date: 2022-02-04T05:00:00Z
   Registrar: CSC Corporate Domains, Inc.
   Registrar IANA ID: 299
   Registrar Abuse Contact Email: domainabuse@cscglobal.com
   Registrar Abuse Contact Phone: 8887802723
   Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
   Domain Status: serverDeleteProhibited https://icann.org/epp#serverDeleteProhibited
   Domain Status: serverTransferProhibited https://icann.org/epp#serverTransferProhibited
   Domain Status: serverUpdateProhibited https://icann.org/epp#serverUpdateProhibited
   Name Server: NS-1183.AWSDNS-19.ORG
   Name Server: NS-1554.AWSDNS-02.CO.UK
   Name Server: NS-265.AWSDNS-33.COM
   Name Server: NS-661.AWSDNS-18.NET
   DNSSEC: unsigned
   URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

Domain Name: horchow.com
Registry Domain ID: 305895_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.corporatedomains.com
Registrar URL: www.cscprotectsbrands.com
Updated Date: 2021-01-31T01:09:15Z
Creation Date: 1996-02-03T00:00:00Z
Registrar Registration Expiration Date: 2022-02-04T05:00:00Z
Registrar: CSC CORPORATE DOMAINS, INC.
Sponsoring Registrar IANA ID: 299
Registrar Abuse Contact Email: domainabuse@cscglobal.com
Registrar Abuse Contact Phone: +1.8887802723
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: serverDeleteProhibited http://www.icann.org/epp#serverDeleteProhibited
Domain Status: serverTransferProhibited http://www.icann.org/epp#serverTransferProhibited
Domain Status: serverUpdateProhibited http://www.icann.org/epp#serverUpdateProhibited
Registry Registrant ID: 
Registrant Name: NM Nevada Trust NM Nevada Trust
Registrant Organization: NM Nevada Trust
Registrant Street: 3200 Las Vegas Boulevard
Registrant City: Las Vegas
Registrant State/Province: NV
Registrant Postal Code: 89109
Registrant Country: US
Registrant Phone: +1.2147416911
Registrant Phone Ext: 
Registrant Fax: 
Registrant Fax Ext: 
Registrant Email: NMG_legal@neimanmarcus.com
Registry Admin ID: 
Admin Name: Neiman Marcus
Admin Organization: Neiman Marcus Group, Inc.
Admin Street: 111 Customer Way
Admin City: Irving
Admin State/Province: TX
Admin Postal Code: 75039
Admin Country: US
Admin Phone: +1.9724016300
Admin Phone Ext: 
Admin Fax: 
Admin Fax Ext: 
Admin Email: DNSADMIN@neimanmarcus.com
Registry Tech ID: 
Tech Name: DBMS Tech
Tech Organization: VeriSign, Inc.
Tech Street: VeriSign, Inc.
Tech City: Mountain View
Tech State/Province: CA
Tech Postal Code: 94043
Tech Country: US
Tech Phone: +1.8005792848
Tech Phone Ext: 
Tech Fax: +1.6502378883
Tech Fax Ext: 
Tech Email: dbms-tech@verisign.com
Name Server: ns-265.awsdns-33.com
Name Server: ns-1554.awsdns-02.co.uk
Name Server: ns-661.awsdns-18.net
Name Server: ns-1183.awsdns-19.org
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/

Corporation Service Company(c) (CSC)  The Trusted Partner of More than 50% of the 100 Best Global Brands.

Register your domain name at http://www.cscglobal.com